<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17915

Description Uncharacterized protein
SequenceMADKQLIVAVEGTAAMGPFWSIIVSDYLEKIIRCYCGNETSGQKPPTSSAELSLVTFNSHGSYSACLVQRSGWTRDVDIFLHWLSAIPFAGGGFNDAAIAEGLSEALMMFPITPNGNQTQPNTDGQRNCILIAASNPHPLPTPVYRPQIQNLEQTENIDAQNESRLSDAETVAKSFPQCSVSLSVICPKQLPKLRLIYNAGKRNSRAADPPVDNIKNPHFLVLISENFMEARAALSRPGATSLPSNQTPVKVDIASVTSVTGPLPASIPSVNGSITNRPPISVGNLPTATVKVEPSTITSMANGSAFPHITSVPRPSSQGVPSMQTSSPSTTTQDMATNGENAQDLKPNVSVTTQSARSAPPAAANVNILNNLSQARQVMNSAALSGGTSIGLPSINQTSVAMHMSSMISSGMTSSVPAAQTVFSSGQPGVSSITGSGNLTGTTQITPNSGLGSFTSATSNMPGNSNLGGISQPMGNLHAGVSISQSAMSGLGTNPNTMSGSGAQMVQSGMGANPNTMSGLGASGVSSGSNTMIPTPGMSQQVQSGMQPLGANNNSAANLPLSQQTAGGLQPAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQISSQQQQMQQQHHQQMQQQQHPQLQQLQHQQQLPQLQQQQQLSQLQQQQQQLSQLQQQQLPQMQQQLPQMHSSYLNCSSSSSSHSFNSSSSNCSSSSSSNCSSSSSSKCSSSSSSSFSKCSSSSKWLEQEWVKLMFKVQVVHN
Length841
PositionUnknown
OrganismPopulus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
Aromaticity0.04
Grand average of hydropathy-0.333
Instability index53.37
Isoelectric point8.80
Molecular weight89182.15
Publications
PubMed=16973872

Function

Annotated function
ECO:0000256	RuleBase:RU364144
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
transcription regulator complex	GO:0005667	IBA:GO_Central
GO - Biological Function
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP17915
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      91.42|      16|      16|     786|     801|       1
---------------------------------------------------------------------------
  770-  784 (25.95/ 8.67)	.SSYLNCSSSSSSHSF
  785-  800 (33.73/13.21)	NSSSSNCSSSSSSNCS
  801-  816 (31.73/12.05)	SSSSSKCSSSSSSSFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.45|      15|      16|     724|     738|       3
---------------------------------------------------------------------------
  704-  718 (25.82/ 8.75)	Q..QMQQQHhQQMQQQQ
  724-  738 (33.43/13.31)	QL.QHQQQL.PQLQQQQ
  742-  757 (26.20/ 8.97)	QLqQQQQQL.SQLQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     131.86|      26|      66|     448|     473|       4
---------------------------------------------------------------------------
  348-  375 (29.47/11.00)	PNVSV.TTQSARSAPPAAANvniLNNLSQ
  381-  398 (22.34/ 6.16)	NSAALSGGTSI........G...LPSINQ
  404-  428 (32.08/12.77)	HMSSMIS.SGMTSSVPAAQT...VFSSGQ
  448-  473 (47.97/23.53)	PNSGLGSFTSATSNMPGNSN...LGGISQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.07|      12|      20|     507|     525|       5
---------------------------------------------------------------------------
  507-  519 (20.89/ 8.18)	VQSG...MGANPnTMS
  526-  540 (17.18/12.98)	VSSGsntMIPTP.GMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     100.98|      28|      29|     246|     274|       6
---------------------------------------------------------------------------
  246-  274 (45.63/24.75)	NQTPVKVdIASVTSVTGPLP........ASIPS.VNGS
  277-  305 (24.52/ 7.92)	NRPPISV.........GNLPtatvkvepSTITSmANGS
  307-  327 (30.83/11.54)	........FPHITSVPRPSS........QGVPS.MQTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.76|      28|      38|     111|     138|       7
---------------------------------------------------------------------------
  111-  138 (52.83/25.70)	PITPNGNQTQPNTDGQRNCIL.....IAASNPH
  147-  178 (38.57/17.10)	PQIQNLEQTE.NIDAQNESRLsdaetVAKSFPQ
  188-  211 (35.36/15.17)	PKQLPKLRLIYNA.GKRNS.......RAADPP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.98|      20|      20|     546|     565|       8
---------------------------------------------------------------------------
  546-  565 (35.33/21.49)	GMQPL...........GAN..NNSAANLPLSQQ
  569-  590 (29.00/16.07)	GLQPA...........QSKyvKVWEGNLSGQRQ
  591-  620 (26.65/14.06)	G.QPVfitrlegyrsaSAS..ETLAANWPPTMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.91|      27|      29|      52|      80|      11
---------------------------------------------------------------------------
   52-   80 (43.92/31.04)	LSLVTFNSHGSYSACLVQrsGWTRDVDIF
   84-  110 (45.99/26.49)	LSAIPFAGGGFNDAAIAE..GLSEALMMF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP17915 with Med25 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) AMHMSSMISSGMTSSVPAAQTVFSSGQPGVSSITGSGNLTGTTQITPNSGLGSFTSATSNMPGNSNLGGISQPMGN
2) PASIPSVNGSITNRPPISVGNLPTATVKVEPSTITSMANGSAFPHITSVPRPSSQGVPSMQTSSPSTTTQDMATNGENAQDLKPNVSVTTQSARSAPPAAANVNILNN
3) VSISQSAMSGLGTNPNTMSGSGAQMVQSGMGANPNTMSGLGASGVSSGSNTMIPTPGMSQQVQSGMQPLGANNNSAANLPLSQQT
402
265
482
477
372
566

Molecular Recognition Features

MoRF SequenceStartStop
NANANA