<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17913
Description |
Uncharacterized protein |
Sequence | MDPESKKFGIGPRELTGAVDLISHYKLLPHYEYFCKRSLPLSIADTHYLHNVVGDTEIRKGERMQLDQLIQNTSRDSNACIQPFDLNVLREAFQLKETTPIDLPSAEKGTPTIAGKSKGESKDKDRKHKKQKDRDKEKDKEHKKHKRRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHEKKRKHDGDEDLNDVHKHKKSKHKSSKIDEIGVIKVAG |
Length | 219 |
Position | Head |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.490 |
Instability index | 43.19 |
Isoelectric point | 9.53 |
Molecular weight | 25310.25 |
Publications | PubMed=16973872
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17913
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.06| 19| 19| 123| 141| 1
---------------------------------------------------------------------------
123- 141 (34.61/12.31) DKDRKHKKQKDRDKEKDKE
143- 161 (32.46/11.11) KKHKRRHKDKDRSKDKDKE
---------------------------------------------------------------------------
|