Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSKETDNNPDTPSSPKKIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEHVKFIMYPHCLYFLELLQNANFRNAMAHPGNKELAHRQQFFFWKNYRNNRLKHILPRPLPEPVTAPPALAPPPQTPVQPVPPVSAATLGMPAAPGAVPLPMPPGSAFGKSDIRNSGSDRRKRKKEV |
Length | 201 |
Position | Middle |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.677 |
Instability index | 58.16 |
Isoelectric point | 9.49 |
Molecular weight | 23071.19 |
Publications | PubMed=16973872 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP17902 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.83| 18| 19| 133| 151| 1 --------------------------------------------------------------------------- 133- 151 (33.02/18.16) PLPePVTAPPALAP..PPQTP 154- 173 (30.82/12.93) PVP.PVSAATLGMPaaPGAVP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.80| 19| 22| 28| 49| 2 --------------------------------------------------------------------------- 28- 49 (29.18/25.35) RQRFLLELEFVQCLanpTYIHY 52- 70 (34.62/20.86) QNRYFEDEAFIGYL...KYLQY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FGKSDIRNSG 2) SPKKIYKD | 182 16 | 191 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab