| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASSKETDNNPDTPSSPKKIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEHVKFIMYPHCLYFLELLQNANFRNAMAHPGNKELAHRQQFFFWKNYRNNRLKHILPRPLPEPVTAPPALAPPPQTPVQPVPPVSAATLGMPAAPGAVPLPMPPGSAFGKSDIRNSGSDRRKRKKEV |
| Length | 201 |
| Position | Middle |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.677 |
| Instability index | 58.16 |
| Isoelectric point | 9.49 |
| Molecular weight | 23071.19 |
| Publications | PubMed=16973872 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP17902
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.83| 18| 19| 133| 151| 1
---------------------------------------------------------------------------
133- 151 (33.02/18.16) PLPePVTAPPALAP..PPQTP
154- 173 (30.82/12.93) PVP.PVSAATLGMPaaPGAVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.80| 19| 22| 28| 49| 2
---------------------------------------------------------------------------
28- 49 (29.18/25.35) RQRFLLELEFVQCLanpTYIHY
52- 70 (34.62/20.86) QNRYFEDEAFIGYL...KYLQY
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FGKSDIRNSG 2) SPKKIYKD | 182 16 | 191 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab