<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17888

Description Uncharacterized protein
SequenceMDIDDFRLILESSGVDVWTFIDTAIVVASLDFGSELKRRRDDIVERLFASSSSCSRCRDRSLNDINMNNTSNGDEIKGLVEKESSHEEEKGTRVAADSPVTPRSVNGDGDDDELDPYGGLFDDEPKKILVIKQQLEDIDQPEDSLVDLLQSLADMDITFQALKETDIGRHVNRLRKHPSNDVRRLVKQLVRKWKEIVDDWVRLNPQGEHASSGLMADGDSPQQKIPQNGHHQVPDFAYSPNPHNGSSGSDRNNSEPERKPKPAPPRNQAPTKPTQKPVPASSPAPYNVQRQREQPKASSFDADQRLASASKRLQANYKEAENAKKQRTIQVMDIHEIPKPKNKNTFFPKNRGAGGSHQGRHW
Length362
PositionUnknown
OrganismPopulus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
Aromaticity0.05
Grand average of hydropathy-1.008
Instability index50.99
Isoelectric point6.10
Molecular weight40661.56
Publications
PubMed=16973872

Function

Annotated function
GO - Cellular Component
cyclin-dependent protein kinase holoenzyme complex	GO:0000307	IBA:GO_Central
cytoplasm	GO:0005737	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IBA:GO_Central
GO - Biological Process
mitotic cell cycle phase transition	GO:0044772	IBA:GO_Central
regulation of cyclin-dependent protein serine/threonine kinase activity	GO:0000079	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP17888
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.82|      15|      15|     123|     137|       1
---------------------------------------------------------------------------
  123-  137 (25.75/17.27)	DEPKKILV.IKQQLED
  139-  154 (21.08/12.90)	DQPEDSLVdLLQSLAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.37|      15|      15|     205|     219|       2
---------------------------------------------------------------------------
  205-  219 (27.04/16.85)	PQGEHASSGLMADGD
  221-  235 (28.33/18.01)	PQQKIPQNGHHQVPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.96|      33|      33|     260|     292|       4
---------------------------------------------------------------------------
  260-  292 (58.83/28.17)	PKPAPPRNQAPTKPTQKPVPASSPAPYNVQRQR
  295-  327 (49.13/22.52)	PKASSFDADQRLASASKRLQANYKEAENAKKQR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP17888 with Med26 domain of Kingdom Viridiplantae

Unable to open file!