<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17886
| Description |
Uncharacterized protein |
| Sequence | MIEVIFLVGHNPMDANNWRPTAPGGEPVIDTGDWRIQLQPDSRKRIVDKIIEILKRHLPFSGQEGLQELKKIVVRFEEKIYTAATNQSDYLRKISLKMLTMETRSQNTIPTGNGISADGHSQSEN |
| Length | 125 |
| Position | Tail |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.561 |
| Instability index | 53.02 |
| Isoelectric point | 6.84 |
| Molecular weight | 14170.99 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17886
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.07| 11| 14| 9| 19| 1
---------------------------------------------------------------------------
9- 19 (23.85/16.84) GHNPMDANNWR
25- 35 (22.22/15.26) GEPVIDTGDWR
---------------------------------------------------------------------------
|