Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MEVLNLIDDGKNPDEFTRGVINSCITKNQVTKGKTDAFKSLCKHQLEELEQTFPDEVESYWEIRAMSAAVSYIYDFIEWISQQCKSLSMRYIMVGNNNP |
Length | 99 |
Position | Middle |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.447 |
Instability index | 23.91 |
Isoelectric point | 4.75 |
Molecular weight | 11445.85 |
Publications | PubMed=16973872 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17883 No repeats found No repeats found |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) RYIMVGNNNP 2) VSYIYDFIEWI | 90 70 | 99 80 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab