<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17878
| Description |
Uncharacterized protein |
| Sequence | MASTGDSLFRLLTVAPRSRELSGTVDLISHYQLREPFEAICKKPLPTSISDSKYLSNVVGDSEIRRGDDMELGQLIQGPAGSSMPSDRVPFQPFDIEVLRRAFALKESGPISLPESERGLPIIRSKSKHQDDEKKKRKHKHRSKDRDKDKDKERKKDRDKDKKRDKDKDKDRSKGENGEKKHKKKKRRHDGEDGDDGHKHKSKKHKHSSKVEGQTVLIKNGK |
| Length | 222 |
| Position | Head |
| Organism | Physcomitrella patens subsp. patens (Moss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.449 |
| Instability index | 55.50 |
| Isoelectric point | 9.82 |
| Molecular weight | 25405.43 |
| Publications | PubMed=18079367
PubMed=29237241
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17878
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.71| 17| 17| 138| 154| 1
---------------------------------------------------------------------------
124- 141 (25.39/ 6.79) RSKSKHQDDEKKK..rKHKH
142- 159 (24.69/ 6.43) RSKDRDKDKDKER..kKDRD
188- 207 (25.63/ 6.91) RHDGEDGDDGHKHkskKHKH
---------------------------------------------------------------------------
|