<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17877
| Description |
Uncharacterized protein |
| Sequence | MQGRLPDLREPYSIWFSSFVSQSAAGMASNGDCFFRMLAIAPRPRELTGAVDLVSHYQLKEQFEAFCKKPSPTSVSDSMYLGNVVGDSEFRRGEGMELCQLVQGSAGSWMPSDRVPFQHFDIELLRRAFALKETGPIFLPESERGLPTIRVKSKDQDEDKKKRKHKHRSKDREKAKDKEKKKDRDKDKKRDKDKDKDRSKGENGEKKHKKKKRRHDGEEGDDGHKHKSKKRKHSSKMEGQTILIKSGK |
| Length | 248 |
| Position | Head |
| Organism | Physcomitrella patens subsp. patens (Moss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.274 |
| Instability index | 50.60 |
| Isoelectric point | 9.76 |
| Molecular weight | 28544.14 |
| Publications | PubMed=18079367
PubMed=29237241
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.89| 15| 15| 201| 215| 1
---------------------------------------------------------------------------
201- 215 (29.03/12.74) GENGE..KKHKKKKRRH
217- 233 (22.86/ 8.62) GEEGDdgHKHKSKKRKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.69| 15| 15| 164| 178| 2
---------------------------------------------------------------------------
164- 178 (28.15/12.95) KHKHRSKD..REKAKDK
180- 196 (23.54/ 9.75) KKKDRDKDkkRDKDKDK
---------------------------------------------------------------------------
|