<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17872
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MVSSCTTDILPGLEEEGLRQLYPTGSDVDYKKELRALNRELILQFLELIDALIERPSQSARCVEDITLILRNVHHLLNSLRPHQARATVIHMLEAQLIRRKEALAKIRSLDDLKRLGLFEGMLCCMRKISDNCWYCYQSIVG |
| Length | 142 |
| Position | Middle |
| Organism | Physcomitrella patens subsp. patens (Moss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.094 |
| Instability index | 60.59 |
| Isoelectric point | 6.89 |
| Molecular weight | 16352.96 |
| Publications | PubMed=18079367
PubMed=29237241
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17872
No repeats found
No repeats found
|