Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATPTDGLPGTEMTSISFRDQLWLSAYPLDRNLVFDYFALSPFYDRTCNNEQLRMEAIHPLDMTHLSKKTGMEYILHEAQEPHLFVIRKQKRDGPEKVSAQAAYYVLDGSIYQAPHLYNVIGSRVVRSLYHITNAFAQASAKLEKIGTGTDNENEKVVGEADPADVQVKQSTTKFVDMKEVMRVDSILAGIMRKLPPAPPPPAPLVPVNNAAPGTETAQTPAAAEVKQEQTSAGGKQSNIEGGATKRLKIERY |
Length | 253 |
Position | Head |
Organism | Physcomitrella patens subsp. patens (Moss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta> Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.446 |
Instability index | 50.16 |
Isoelectric point | 6.32 |
Molecular weight | 27944.43 |
Publications | PubMed=18079367 PubMed=29237241 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP17860 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.01| 12| 30| 74| 85| 1 --------------------------------------------------------------------------- 74- 85 (24.01/16.50) YILHEA..QEPHLF 105- 118 (19.01/11.67) YVLDGSiyQAPHLY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GKQSNIEGGATKRLKIERY 2) LAGIMR 3) TPAAAEVKQE | 235 188 220 | 253 193 229 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab