<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17856
| Description |
Uncharacterized protein |
| Sequence | MSSASTSGSFVLTEPQHPVAGRRTVYGQLQELKKLYLDDMIELYSMLTARSNQPMPAEQLQKLKHYKDVLHRMIPYLRVPEDRVPKEFNADKVDAFEKQIVNIMETFKRRRQGVA |
| Length | 115 |
| Position | Tail |
| Organism | Physcomitrella patens subsp. patens (Moss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.594 |
| Instability index | 71.99 |
| Isoelectric point | 9.43 |
| Molecular weight | 13381.33 |
| Publications | PubMed=18079367
PubMed=29237241
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17856
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.75| 10| 28| 28| 38| 1
---------------------------------------------------------------------------
28- 38 (14.18/14.12) QLQELKKlYLD
59- 68 (19.57/13.59) QLQKLKH.YKD
---------------------------------------------------------------------------
|