<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17851
Description |
Uncharacterized protein |
Sequence | MTGMSSNGESLFRLLSAAPRTRELTGAVDLISHYQLREHYESFCKKPLSTKVSDSNYLSNVVGDTELRRGEGMELSQLISGPAMTSMPSDRVPFQPFDLEVLRKAFTLKEAGPIFLPESERGVPVAKGDEEKKKKHKKDRDRHHKKDRDKDKDKDKDKKKDRDKDKKREKDKDKDRSKSENGEKKHKKKKRKHEVEEGEDGHKHKSKKHKHSLKVEGHTMKNGK |
Length | 224 |
Position | Head |
Organism | Physcomitrella patens subsp. patens (Moss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.512 |
Instability index | 39.83 |
Isoelectric point | 9.69 |
Molecular weight | 25852.03 |
Publications | PubMed=18079367
PubMed=29237241
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17851
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.67| 14| 15| 180| 193| 1
---------------------------------------------------------------------------
130- 144 (20.94/ 6.27) EEKK..KKHKKdRDRHH
180- 193 (26.56/10.09) ENGE..KKHKK.KKRKH
196- 211 (21.16/ 6.42) EEGEdgHKHKS.KKHKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.45| 15| 21| 146| 160| 2
---------------------------------------------------------------------------
146- 160 (27.40/10.91) KDRDKDKDKDKDKKK
164- 178 (27.06/10.70) KDKKREKDKDKDRSK
---------------------------------------------------------------------------
|