<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17838
Description |
Uncharacterized protein |
Sequence | MSQRQLVVAVEATGALGPFWSVLLTEYVDKIKNGSSPGEVALVVFKTHGSHSDFLLWQSGWTSSMDLFFKWLSALTFEGGGFSEAAVAEALAEALMMCCPGPKPPTVPQHKHCLLIAASNPHPIPTPVMRPPVILLPTGQAELQSDKWWLADAETVAKAFPPAKRNPRAADTGPDFSKQHLVLISEGFSEGKLAFCPAAAASKYCCVV |
Length | 208 |
Position | Unknown |
Organism | Physcomitrella patens subsp. patens (Moss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.120 |
Instability index | 38.93 |
Isoelectric point | 6.29 |
Molecular weight | 22317.57 |
Publications | PubMed=18079367
PubMed=29237241
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17838
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.53| 19| 104| 81| 99| 1
---------------------------------------------------------------------------
81- 99 (35.17/24.14) GFSEAAVA.EALAEALMMCC
187- 206 (33.36/22.53) GFSEGKLAfCPAAAASKYCC
---------------------------------------------------------------------------
|