<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17833
Description |
Uncharacterized protein |
Sequence | MSANYWHSTQCRFWSFTKEQLVTMRQKLEEDNAELVRMFPLPQQRHLYIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVFQPYRTITALRNELSLVDDEVQLARSVINDHFMTDLPLLYPPHIIAMVAILLALVLRPNNSGPGQNTSGAAAAAGLAAAQQALMRAQGQQAQGGMPEPAAAEPKEKRQQDRVSRVQKFAKWLVDSNVEIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
Length | 319 |
Position | Kinase |
Organism | Gibberella nygamai (Bean root rot disease fungus) (Fusarium nygamai) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.269 |
Instability index | 53.80 |
Isoelectric point | 8.95 |
Molecular weight | 36721.99 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17833
No repeats found
|