<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17829
Description |
Uncharacterized protein |
Sequence | MDTSTPSNLMDKHQKIISEILRSYRDLINCVTVNGMDKEKQGDYEAQANKLNYRDPDVMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADEHRKQKEAQIDRDVTEITTLFNKIDANAMRDLAEKNGGTWEPQGEAALTAPAAPAPTGN |
Length | 159 |
Position | Head |
Organism | Gibberella nygamai (Bean root rot disease fungus) (Fusarium nygamai) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.732 |
Instability index | 23.81 |
Isoelectric point | 5.14 |
Molecular weight | 17908.94 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17829
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.53| 21| 27| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (35.02/32.05) YRDlINCVTVNGMDKEKQGD..YE
53- 75 (33.50/25.05) YRD.PDVMAAAGLRTQRKFDelYE
---------------------------------------------------------------------------
|