<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17820
| Description |
Uncharacterized protein |
| Sequence | MGDRLTQLQDAVDQLATQFVACLHYVNKRHDLETLVDSLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQERYIKELEEDLKIAEAQRQEAIKEKDQILSELDSVIRSIRRP |
| Length | 121 |
| Position | Middle |
| Organism | Gibberella nygamai (Bean root rot disease fungus) (Fusarium nygamai) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.493 |
| Instability index | 62.67 |
| Isoelectric point | 4.48 |
| Molecular weight | 13933.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17820
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.70| 28| 33| 30| 61| 1
---------------------------------------------------------------------------
33- 61 (44.59/36.96) ETLVDSLPP......DEFRAgMVELSQDLIVKEQQ
63- 96 (41.12/20.98) EVLISSLPGldnsemDQERY.IKELEEDLKIAEAQ
---------------------------------------------------------------------------
|