| Description | Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MALSRGLPQSKEALLKSYTTRLKDDVKSMLENFEEIVKLAKGENDTQLSKMTQSEQDTYEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLKSLRDDMAADLYDLEEEYYTSIYK |
| Length | 140 |
| Position | Head |
| Organism | Cryptotermes secundus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.639 |
| Instability index | 44.24 |
| Isoelectric point | 5.13 |
| Molecular weight | 16142.16 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP17803 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ADLYDL 2) LENFEEIVKL 3) LLKSY | 125 30 14 | 130 39 18 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab