Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MALSRGLPQSKEALLKSYTTRLKDDVKSMLENFEEIVKLAKGENDTQLSKMTQSEQDTYEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLKSLRDDMAADLYDLEEEYYTSIYK |
Length | 140 |
Position | Head |
Organism | Cryptotermes secundus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.639 |
Instability index | 44.24 |
Isoelectric point | 5.13 |
Molecular weight | 16142.16 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17803 No repeats found |
MoRF Sequence | Start | Stop |
1) ADLYDL 2) LENFEEIVKL 3) LLKSY | 125 30 14 | 130 39 18 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab