Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MSESLAKLAQKIDFSKASTEEIVKEGADQQDKNDEDSATKESATFQSSLWPWDSVRNKLRNALTEVCVLADVLAIAKEKRYIVLDHVPQDALETKPMVQVYARKKALAGAASVLLAGAERLRASQNELARNRTTPDFHIELLRLRQNWRLKKVSNSIIGDLSYRTAGSKYAQTGMFEVTKAEEEPQATGSPPPSPGAGAAAGPPKSSSALRVTVPSELQGVAYIEVLCQKDQEDLCSATINLLGSGPASTNPDVHWQQKLEAAQNVLFCKELFNQLAKEAVQLQAPIPHMVVGNQIMATVLPGIQLIIGLYHSTGNDKKPNPTPPQKSEHDHVLEHSLHQLLREVHHKNTHHPFPHPSSGPVGPSKKRCLAGPMAADRYELLEMTKSQTLLEQIIQQAQHFFMRLRTEYVLDTIAKEVKDPLIVSHWNALNSPTQSCVKINIMTHGYDSVYRTSLVVHVGEKSLKCVCRDGRVMHMSYEPQELRDLIFCQIYQHQITAVQGLAKCMGWQFLANSTHLGLGAVEPLGNASSCILASPIGDRIIAVRCEPQTGVQVAIAQSPRKDFFPGQLVKERKWENLGGSFKEVRWDKMEGKNFLNKMELLMSSLTSSQ |
Length | 610 |
Position | Head |
Organism | Cryptotermes secundus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.350 |
Instability index | 43.39 |
Isoelectric point | 8.15 |
Molecular weight | 67587.63 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17796 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 156.15| 47| 65| 240| 293| 1 --------------------------------------------------------------------------- 240- 289 (73.37/58.61) INLLGSGPASTNPDVHWQQKLEaAQNVLfcKELFNQLAKEA..VQLQAPIPH 308- 356 (82.77/45.16) IGLYHSTGNDKKPNPTPPQKSE.HDHVL..EHSLHQLLREVhhKNTHHPFPH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASTEEIVK 2) LAKLAQKI | 17 5 | 24 12 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab