<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17783
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MADQYRKVEQYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNLMAYYGLEHSYSKFSGKKVKEQLSSFLPNLPGMIDTPGHLDNSSLRSVIDKPPIGGKELLPLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKAGETPSQETQVTEVGQDTHEKKHKKQKRHDEEKERKKRKKEKKRKKQKHSPEHPGGLTPSQHSSG |
| Length | 236 |
| Position | Head |
| Organism | Cryptotermes secundus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.259 |
| Instability index | 53.43 |
| Isoelectric point | 9.97 |
| Molecular weight | 26558.80 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17783
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.38| 14| 18| 190| 203| 1
---------------------------------------------------------------------------
161- 174 (25.85/13.11) HKNKHKKHKHKAGE
190- 203 (27.68/14.54) HEKKHKKQKRHDEE
211- 223 (23.86/11.56) KEKKRKKQK.HSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.63| 15| 34| 106| 121| 3
---------------------------------------------------------------------------
106- 121 (23.39/15.67) PGHLDNsSLRSVIDKP
143- 157 (30.24/16.26) PGPLPE.QYRYVNQAP
---------------------------------------------------------------------------
|