<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17780

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMAAEDSSWRTATFRQSVVVKIDEAIRTSGMPTSKNSMEMENHVFQKAKSKEEYLGFVARLILHVREMNAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDG
Length369
PositionTail
OrganismCryptotermes secundus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes.
Aromaticity0.02
Grand average of hydropathy-0.460
Instability index66.95
Isoelectric point10.23
Molecular weight38411.62
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17780
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.74|      17|      27|     102|     123|       2
---------------------------------------------------------------------------
  102-  123 (28.30/17.58)	TGNQimglGPQG.GGMvQP..SSIP
  130-  149 (25.44/ 6.07)	TLNQ....RPQGlSGM.QPmqDKIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.87|      14|      18|     292|     305|       4
---------------------------------------------------------------------------
  292-  305 (27.68/11.56)	SPALAPSPSSQL.TP
  312-  326 (21.19/ 6.93)	SGGMAPSPSSSLnTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     123.18|      27|      27|     199|     225|       5
---------------------------------------------------------------------------
  199-  225 (50.53/23.32)	QMG..GQLQGQIQGQSLGQMPQMAGQMP..G
  226-  251 (38.13/15.41)	QMShmTQMQQPRKG...GEGIMMTGQNA..G
  259-  287 (34.53/13.11)	ASS..AFLRRSPSPSALQASPAGLGAAPasN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17780 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDG
68
369










Molecular Recognition Features






MoRF SequenceStartStop




1) QEDQA
339
343