<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17779

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMAAEDSSWRTATFRQSVVVKIDEAIRTSGMPTSKNSMEMENHVFQKAKSKEEYLGFVARLILHVREMNAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDDVEKLSKMKKLLEILSTPSRRMPLETLIKCEVVLEKLDFKRGEGSVAPQAAHLIPLKEHHIFSPLLEAVNNTLQSPVVNHTLQRTFGPCLEVLFGPEIKMLPPPLKKKKIEESQNDIPDVLQGEIARLDQRFKVSLDPTQQPGSRSVQLLCWLDDRHLPCVPPVSLSVPEDYPHSPPRCHMAPHEHSSTQFLCAVQKALASRIRKLPSRFSVSQLLDTWEMSVRQASAPTQTPVSAATVLMGL
Length611
PositionTail
OrganismCryptotermes secundus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes.
Aromaticity0.03
Grand average of hydropathy-0.375
Instability index64.33
Isoelectric point9.52
Molecular weight65523.96
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17779
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.92|      22|      26|     186|     210|       1
---------------------------------------------------------------------------
  145-  167 (32.63/ 8.60)	QDKIPPGIGMGpGPQVGPMVG.....MP
  191-  217 (36.29/10.04)	QMRVQLPAQMG.GQLQGQIQGqslgqMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     138.94|      26|      27|     274|     299|       2
---------------------------------------------------------------------------
  107-  137 (38.09/12.43)	MGLGPQGGGMV.QPSS..I...PASsllqtlNQRPQG
  252-  279 (29.25/ 7.98)	F.AGP..RNVASSAFLrrS...PSP...salQASPAG
  280-  305 (32.49/ 9.61)	LGAAPASNQMAASPAL..A...PSP....ssQLTP..
  306-  337 (39.11/12.94)	MSTAQRSGGMAPSPSS..SlntPGP...avpTPSPCS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.67|      16|      23|     346|     365|       3
---------------------------------------------------------------------------
  346-  361 (28.92/23.13)	EKVRQLSKYIE....PLRRM
  371-  390 (22.75/ 7.35)	EKLSKMKKLLEilstPSRRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.44|      17|      23|     496|     515|       4
---------------------------------------------------------------------------
  496-  512 (32.54/21.67)	LDQRF.....KVSLD.PTQQPGS
  521-  543 (23.90/ 7.09)	LDDRHlpcvpPVSLSvPEDYPHS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17779 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQA
68
343










Molecular Recognition Features






MoRF SequenceStartStop




NANANA