<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17779
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MAAEDSSWRTATFRQSVVVKIDEAIRTSGMPTSKNSMEMENHVFQKAKSKEEYLGFVARLILHVREMNAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDDVEKLSKMKKLLEILSTPSRRMPLETLIKCEVVLEKLDFKRGEGSVAPQAAHLIPLKEHHIFSPLLEAVNNTLQSPVVNHTLQRTFGPCLEVLFGPEIKMLPPPLKKKKIEESQNDIPDVLQGEIARLDQRFKVSLDPTQQPGSRSVQLLCWLDDRHLPCVPPVSLSVPEDYPHSPPRCHMAPHEHSSTQFLCAVQKALASRIRKLPSRFSVSQLLDTWEMSVRQASAPTQTPVSAATVLMGL |
| Length | 611 |
| Position | Tail |
| Organism | Cryptotermes secundus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.375 |
| Instability index | 64.33 |
| Isoelectric point | 9.52 |
| Molecular weight | 65523.96 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17779
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.92| 22| 26| 186| 210| 1
---------------------------------------------------------------------------
145- 167 (32.63/ 8.60) QDKIPPGIGMGpGPQVGPMVG.....MP
191- 217 (36.29/10.04) QMRVQLPAQMG.GQLQGQIQGqslgqMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 138.94| 26| 27| 274| 299| 2
---------------------------------------------------------------------------
107- 137 (38.09/12.43) MGLGPQGGGMV.QPSS..I...PASsllqtlNQRPQG
252- 279 (29.25/ 7.98) F.AGP..RNVASSAFLrrS...PSP...salQASPAG
280- 305 (32.49/ 9.61) LGAAPASNQMAASPAL..A...PSP....ssQLTP..
306- 337 (39.11/12.94) MSTAQRSGGMAPSPSS..SlntPGP...avpTPSPCS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.67| 16| 23| 346| 365| 3
---------------------------------------------------------------------------
346- 361 (28.92/23.13) EKVRQLSKYIE....PLRRM
371- 390 (22.75/ 7.35) EKLSKMKKLLEilstPSRRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.44| 17| 23| 496| 515| 4
---------------------------------------------------------------------------
496- 512 (32.54/21.67) LDQRF.....KVSLD.PTQQPGS
521- 543 (23.90/ 7.09) LDDRHlpcvpPVSLSvPEDYPHS
---------------------------------------------------------------------------
|