<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17778
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDDVEKLSKMKKLLEILSTPSRRMPLETLIKCEVVLEKLDFKRGEGSVAPQAAHLIPLKEHHIFSPLLEAVNNTLQSPVVNHTLQRTFGPCLEVLFGPEIKMLPPPLKKKKIEESQNDIPDVLQGEIARLDQRFKVSLDPTQQPGSRSVQLLCWLDDRHLPCVPPVSLSVPEDYPHSPPRCHMAPHEHSSTQFLCAVQKALASRIRKLPSRFSVSQLLDTWEMSVRQASAPTQTPVSAATVLMGL |
| Length | 505 |
| Position | Tail |
| Organism | Cryptotermes secundus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.358 |
| Instability index | 70.14 |
| Isoelectric point | 9.45 |
| Molecular weight | 54185.19 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 103.66| 21| 26| 80| 104| 1
---------------------------------------------------------------------------
49- 71 (32.31/ 7.51) GPGPqvGPM.VGMPGQMqSGPLPN
80- 100 (41.93/20.25) GQIP..TQMRVQLPAQM.GGQLQG
108- 123 (29.42/ 8.13) GQMP...QMAGQMPGQM.SH....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.19| 19| 23| 178| 199| 2
---------------------------------------------------------------------------
179- 199 (31.16/15.41) ASNQMaaSPALAPSPSSQL.TP
201- 220 (32.02/ 8.36) STAQR..SGGMAPSPSSSLnTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.67| 16| 23| 240| 259| 4
---------------------------------------------------------------------------
240- 255 (28.92/25.66) EKVRQLSKYIE....PLRRM
265- 284 (22.75/ 8.17) EKLSKMKKLLEilstPSRRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.44| 17| 23| 390| 409| 5
---------------------------------------------------------------------------
390- 406 (32.54/20.58) LDQRF.....KVSLD.PTQQPGS
415- 437 (23.90/ 6.64) LDDRHlpcvpPVSLSvPEDYPHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 111.50| 36| 46| 287| 323| 6
---------------------------------------------------------------------------
287- 323 (57.90/43.18) ETLiKCEVVLEKLDFKRG...EGSVAPQAAHL.IPLKEHHI
333- 372 (53.60/34.97) NTL.QSPVVNHTLQRTFGpclEVLFGPEIKMLpPPLKKKKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.23| 19| 26| 131| 149| 8
---------------------------------------------------------------------------
131- 149 (35.30/18.94) R.........KGGEGIMMTGQNAGF.AGP
150- 178 (20.93/ 8.06) RnvassaflrRSPSPSALQASPAGLgAAP
---------------------------------------------------------------------------
|