<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17778

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDDVEKLSKMKKLLEILSTPSRRMPLETLIKCEVVLEKLDFKRGEGSVAPQAAHLIPLKEHHIFSPLLEAVNNTLQSPVVNHTLQRTFGPCLEVLFGPEIKMLPPPLKKKKIEESQNDIPDVLQGEIARLDQRFKVSLDPTQQPGSRSVQLLCWLDDRHLPCVPPVSLSVPEDYPHSPPRCHMAPHEHSSTQFLCAVQKALASRIRKLPSRFSVSQLLDTWEMSVRQASAPTQTPVSAATVLMGL
Length505
PositionTail
OrganismCryptotermes secundus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes.
Aromaticity0.03
Grand average of hydropathy-0.358
Instability index70.14
Isoelectric point9.45
Molecular weight54185.19
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP17778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.66|      21|      26|      80|     104|       1
---------------------------------------------------------------------------
   49-   71 (32.31/ 7.51)	GPGPqvGPM.VGMPGQMqSGPLPN
   80-  100 (41.93/20.25)	GQIP..TQMRVQLPAQM.GGQLQG
  108-  123 (29.42/ 8.13)	GQMP...QMAGQMPGQM.SH....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.19|      19|      23|     178|     199|       2
---------------------------------------------------------------------------
  179-  199 (31.16/15.41)	ASNQMaaSPALAPSPSSQL.TP
  201-  220 (32.02/ 8.36)	STAQR..SGGMAPSPSSSLnTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.67|      16|      23|     240|     259|       4
---------------------------------------------------------------------------
  240-  255 (28.92/25.66)	EKVRQLSKYIE....PLRRM
  265-  284 (22.75/ 8.17)	EKLSKMKKLLEilstPSRRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.44|      17|      23|     390|     409|       5
---------------------------------------------------------------------------
  390-  406 (32.54/20.58)	LDQRF.....KVSLD.PTQQPGS
  415-  437 (23.90/ 6.64)	LDDRHlpcvpPVSLSvPEDYPHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.50|      36|      46|     287|     323|       6
---------------------------------------------------------------------------
  287-  323 (57.90/43.18)	ETLiKCEVVLEKLDFKRG...EGSVAPQAAHL.IPLKEHHI
  333-  372 (53.60/34.97)	NTL.QSPVVNHTLQRTFGpclEVLFGPEIKMLpPPLKKKKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.23|      19|      26|     131|     149|       8
---------------------------------------------------------------------------
  131-  149 (35.30/18.94)	R.........KGGEGIMMTGQNAGF.AGP
  150-  178 (20.93/ 8.06)	RnvassaflrRSPSPSALQASPAGLgAAP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP17778 with Med15 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQA
1
237

Molecular Recognition Features

MoRF SequenceStartStop
NANANA