<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17777
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MAAEDSSWRTATFRQSVVVKIDEAIRTSGMPTSKNSMEMENHVFQKAKSKEEYLGFVARLILHVREMNAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDDVEKLSKMKKLLEILSTPSRRMPLETLIKCEVVLEKLDFKRNAPPSIEKEENRGISK |
| Length | 425 |
| Position | Tail |
| Organism | Cryptotermes secundus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.482 |
| Instability index | 66.90 |
| Isoelectric point | 9.97 |
| Molecular weight | 44946.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17777
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.70| 17| 17| 181| 197| 1
---------------------------------------------------------------------------
190- 209 (24.11/ 6.32) TQMRVQLPaqmGGQLQGQIQ
210- 228 (26.59/ 7.78) GQSLGQMP.qmAGQMPGQMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 121.57| 16| 17| 155| 170| 2
---------------------------------------------------------------------------
72- 86 (25.95/ 6.69) GPGIGV.PGGGTGGQA
108- 122 (26.99/ 7.23) GLGPQGGGMVQ.PSSI
155- 170 (37.50/12.65) GPGPQVGPMVGMPGQM
173- 188 (31.13/ 9.37) GPLPNVSCPSQMPGQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.37| 16| 19| 288| 305| 3
---------------------------------------------------------------------------
288- 305 (28.96/15.68) QMaaSPALAPSPSSQL.TP
310- 326 (27.41/ 9.92) QR..SGGMAPSPSSSLnTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.45| 20| 26| 346| 365| 4
---------------------------------------------------------------------------
346- 365 (34.67/21.42) EKVRQLSKYIEPLRRMINRM
371- 390 (32.78/19.91) EKLSKMKKLLEILSTPSRRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.23| 19| 26| 237| 255| 5
---------------------------------------------------------------------------
237- 255 (35.30/15.86) R.........KGGEGIMMTGQNAGF.AGP
256- 284 (20.93/ 6.54) RnvassaflrRSPSPSALQASPAGLgAAP
---------------------------------------------------------------------------
|