<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17776
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MAAEDSSWRTATFRQSVVVKIDEAIRTSGMPTSKNSMEMENHVFQKAKSKEEYLGFVARLILHVREMNAKKGPGIGVPGGGTGGQAAQDPIGALQNLARQGTGNQIMGLGPQGGGMVQPSSIPASSLLQTLNQRPQGLSGMQPMQDKIPPGIGMGPGPQVGPMVGMPGQMQSGPLPNVSCPSQMPGQIPTQMRVQLPAQMGGQLQGQIQGQSLGQMPQMAGQMPGQMSHMTQMQQPRKGGEGIMMTGQNAGFAGPRNVASSAFLRRSPSPSALQASPAGLGAAPASNQMAASPALAPSPSSQLTPMSTAQRSGGMAPSPSSSLNTPGPAVPTPSPCSLQEDQAYREKVRQLSKYIEPLRRMINRMGNDDVEKLSKMKKLLEILSTPSRRMPLETLIKCEVVLEKLDFKRGEGSVAPQAAHLIPLKEHHIFSPLLEAVNNTLQSPVVNHTLQRTFGPCLEVLFGPEIKMLPPPLKKKKIEESQNDIPDVLQGEIARLDQRFKVCIFMLECVCACMCACACACV |
Length | 522 |
Position | Tail |
Organism | Cryptotermes secundus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.302 |
Instability index | 67.78 |
Isoelectric point | 9.25 |
Molecular weight | 55603.02 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17776
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.19| 24| 26| 186| 210| 1
---------------------------------------------------------------------------
190- 217 (37.93/15.30) TQMRVQlP.......AQMGGQLQGQIQGqslGQMP
287- 317 (32.26/ 9.72) NQMAAS.PalapspsSQLTPMSTAQRSG...GMAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.15| 22| 27| 111| 137| 2
---------------------------------------------------------------------------
94- 126 (26.97/12.11) LQNLARQGTGnqimglgpqgGGMvQP..SSIPASS
128- 152 (33.17/11.50) LQTLNQRPQG.........lSGM.QPmqDKIPPGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.67| 16| 28| 346| 361| 3
---------------------------------------------------------------------------
346- 361 (28.92/20.20) EKVRQLSKYIE....PLRRM
371- 390 (22.75/14.39) EKLSKMKKLLEilstPSRRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.26| 16| 17| 155| 170| 4
---------------------------------------------------------------------------
162- 179 (28.81/ 9.40) PMVGMPGQMqsGPLPN...VS
236- 254 (23.45/ 6.36) PRKGGEGIM..MTGQNagfAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 27| 459| 474| 8
---------------------------------------------------------------------------
459- 474 (23.47/15.72) EVLFGpEIKMLPPPLK
487- 501 (26.25/12.64) DVLQG.EIARLDQRFK
---------------------------------------------------------------------------
|