<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17774
Description |
Mediator of RNA polymerase II transcription subunit 20 (Fragment) |
Sequence | VNVSSAGTQRTLHVLHNSEQPASVFSILESGNKTIPLVADGLFDLLMNKMTTIYTSKKQTKIEAKGPRFEIGDFCVKLGSVTMSQNFKGVLVEVEYRPCMVPASCWELMREFLQGFLGSSVQSTPPQYLQNRMNEMYQPIDTIHQYLEQFGAYRKATGVR |
Length | 160 |
Position | Head |
Organism | Cryptotermes secundus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.232 |
Instability index | 43.70 |
Isoelectric point | 8.46 |
Molecular weight | 18017.54 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.46| 15| 15| 117| 131| 1
---------------------------------------------------------------------------
117- 131 (26.87/16.69) LGSSVQS..TPPQYLQN
133- 149 (23.59/13.93) MNEMYQPidTIHQYLEQ
---------------------------------------------------------------------------
|