<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17773
| Description |
Uncharacterized protein (Fragment) |
| Sequence | IVPCSYFSLQQFPMVENRTGPQTIEFLTKRVMALGAVQTGQFLVDCDTFMSVPAVGK |
| Length | 57 |
| Position | Head |
| Organism | Cryptotermes secundus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Kalotermitidae> Cryptotermitinae> Cryptotermes.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.293 |
| Instability index | 45.16 |
| Isoelectric point | 6.20 |
| Molecular weight | 6298.31 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP17773
No repeats found
No repeats found
|