Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MMPGRQSCLSDNPLGLSWHDSAWIPLLNPSNIMEYFSERSNPFFDRTCNNEIVKMQRLNPEQLNNMTGLEYILLHVQEPILYVIRKQHRHSPTHATPLADYYIIAGIVYQAPDLISVINSRIISTVHHLQSAFEEANSYSRYHPSKGYSWDLKERKVPERLAAKKETQREEPSSLFQRHRVDMLLAELTRKFPIPVAAPPQKQPAPEELKTEAREVKTEKPDTPRNMKPPPEKKPRLS |
Length | 238 |
Position | Head |
Organism | Cryptotermes secundus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Kalotermitidae> Cryptotermitinae> Cryptotermes. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.723 |
Instability index | 54.78 |
Isoelectric point | 8.97 |
Molecular weight | 27585.25 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17761 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.66| 16| 30| 189| 204| 1 --------------------------------------------------------------------------- 189- 204 (31.28/15.74) TRKFPIP..VAAPPQKQP 218- 235 (25.37/11.55) TEKPDTPrnMKPPPEKKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 118.39| 30| 30| 52| 81| 2 --------------------------------------------------------------------------- 27- 44 (22.62/ 8.91) ...........LNPSNIMEY.FSER..SNPFF 52- 81 (50.63/26.84) IVKMQRLNPEQLNNMTGLEYILLHV..QEPIL 84- 114 (45.14/23.33) IRKQHRHSPTHATPLADY.YIIAGIvyQAPDL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ELTRKFPIPVAAPP 2) KQPAPEELKTEAREVKTEKPDTPRNMKPPPEKKPRLS | 187 202 | 200 238 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab