Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MVRRHLRSHPSPVRITNANAACSCRSSLQNSASILASNVVALTAHLNNHAELLSKTVVYPSTNYPGRTQEGWLVQLLRKKLEPHVETWVEEGRDIQADLNAGDTEAALLSWAKDWSSERISSYAQEEAGDNYTVAEREMGIENVRTGLRRKLEESESEEEDEDEDEDEEMEDAGVQVTSARRSSMGQVEFGMSEVKKDPNGKARTVEDILRFATSGADLGPVRR |
Length | 224 |
Position | Head |
Organism | Meliniomyces bicolor E |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha> Hyaloscypha bicolor. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.740 |
Instability index | 65.30 |
Isoelectric point | 4.88 |
Molecular weight | 24958.19 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17731 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 113.36| 37| 68| 77| 116| 1 --------------------------------------------------------------------------- 77- 116 (53.07/39.30) LRKKLEPHVETwvEEGRDIQADLNAGDTEAALLSwAKDWS 148- 184 (60.29/32.26) LRRKLEESESE..EEDEDEDEDEEMEDAGVQVTS.ARRSS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGVQVTSARRSSMGQVEFGMSEVKKDPNGKARTVEDILRFATSGADLGPVRR 2) MVRRHLRSH | 173 1 | 224 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab