<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17724
Description |
RNA polymerase II transcription mediator |
Sequence | MADILTQLQDAVDQLANQFVASIYYVHKHHDLLTLGPADTVRQQQKNEGEDPGDRNVDPYPADVFKDGQKELAQDLILKEQQIEYLISILPGLENNEKDQEQTIRQLEEELKIAEEERKQAVKEKEDVLARLDTVLRSVKRP |
Length | 142 |
Position | Middle |
Organism | Hyaloscypha variabilis F |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Hyaloscyphaceae> Hyaloscypha> Hyaloscypha variabilis.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.800 |
Instability index | 51.89 |
Isoelectric point | 4.65 |
Molecular weight | 16346.09 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.67| 20| 23| 37| 58| 1
---------------------------------------------------------------------------
37- 56 (37.90/22.20) PADTVRQQQKNEGED...............PGDRN
61- 95 (26.76/ 9.18) PADVFKDGQKELAQDlilkeqqieylisilPGLEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.19| 14| 23| 98| 112| 2
---------------------------------------------------------------------------
98- 111 (21.55/12.60) KDQEQTIRQLEEEL
116- 129 (20.64/ 7.10) EERKQAVKEKEDVL
---------------------------------------------------------------------------
|