<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17722
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLSTQVANEDLQRALRILQGYCGMKPVTFLRRRLIWEGPRMRNGLKGIDAGFLKRQSQPIWRSLHEQLIRQSYIITLLYDVKREQFGEGEKAGVQDGDEGQKEEDPVIDCDQLLGILRWTDLPDPAGGRPVNSRLLVNIENERGLCTLLKSMNHRLTQEMIQECHRFVLGNVVFDFSRYLQLPPSDTEPVSSIRSKLPAYESLVPFDAENKWVLTASALVFNGSVPDHMQKGIDELMTVKTDFEGCFDFQALDRHIFDTRVKI |
Length | 267 |
Position | Head |
Organism | Hyaloscypha variabilis F |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Hyaloscyphaceae> Hyaloscypha> Hyaloscypha variabilis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.366 |
Instability index | 61.52 |
Isoelectric point | 5.75 |
Molecular weight | 30675.80 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17722
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.46| 10| 20| 27| 36| 1
---------------------------------------------------------------------------
27- 36 (19.69/13.89) GMKPV..TFLRR
48- 59 (13.77/ 7.62) GLKGIdaGFLKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.21| 10| 20| 183| 192| 2
---------------------------------------------------------------------------
183- 192 (19.52/15.23) YLQLPPSDTE
204- 213 (18.69/14.27) YESLVPFDAE
---------------------------------------------------------------------------
|