Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPVSQADSHDVVEKQLKDVIQDLYQLMIQVNSYDLAGRPSRDVLENSVKQLDLTLQKIHTTANNPTTQLPSIPPELIQYVDTGRNPDIYTREFVELARRGNQLMRGKLEAFGSFRDVLAEVMVAGLPELKKDIVDVVVKTGGREEVVEKEDQVS |
Length | 155 |
Position | Middle |
Organism | Hyaloscypha variabilis F |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha> Hyaloscypha variabilis. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.385 |
Instability index | 29.15 |
Isoelectric point | 4.86 |
Molecular weight | 17403.57 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17715 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.00| 22| 22| 6| 27| 1 --------------------------------------------------------------------------- 6- 27 (36.52/25.59) QADSHDVVEKQLKDVIQD.LYQL 30- 52 (32.48/22.05) QVNSYDLAGRPSRDVLENsVKQL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IYTREFVEL 2) LIQYV | 89 77 | 97 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab