<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17712

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMDTMDSIPGDFAVSLKARPSSKNNANLPSLIERINLERGGFQNITEESLRQEIADAELENEDGDDDASSDEDEEEPDRMKELMTSRDEILGQIEKAHQSAMFALDFVSLLLSKDTPVQASLSISPFLRELVGMGTLGADKLYAPRMTDAQKQDNKQVAKGWKSQSVDKTVDSILASASRLEKEIELETKYWQQVLAVSDSGWSVCRLPKERHTLGVRFGFSEASPAFKNRSLAALRRNPDGTISLDQGIASSEPRTLRVRIRIGNNQTGASASPQPVAEDAPIEALILQARNTIFSEELWQEMNREARTLGSYGVQSRDDTLICPLTSTKTAVFDLVPLGESTLSGPDDNMAEGVFISLNLLLTYAHRQNLRRRTQPPPPISAQKKVILPYNLLRAVLTRLKHQETVGQLNNLLGPLCHVMESAQLKPLPTFKVTSTPGTPPAQLPQAEQTILSLVDRLETIATFSMSESTTITIAARTSSFPVGSTFFVSLPPSSPLMSVCPPPQVLTSYPALRDYIHYFTACAVATSIATIPSSSEIDEADIESQAGQWHQTPHPTTLRTVLLTSTAGSKIPKTKQLSISVQPLTSRKKSGIRLRAYWEWNGKEQQEVTVIDERKSSFGFPVLLEDVQMSPKEDSKNLRRGLGEGVYDWVAWEKESGKLWDDGEGEVFRTLESVLADAGK
Length682
PositionHead
OrganismHyaloscypha variabilis F
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha> Hyaloscypha variabilis.
Aromaticity0.06
Grand average of hydropathy-0.390
Instability index55.44
Isoelectric point5.21
Molecular weight75209.07
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17712
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.20|      22|      26|     225|     250|       1
---------------------------------------------------------------------------
  225-  250 (32.57/29.40)	PafknRSL.AALR..RNPDGTISLDQGIA
  254-  278 (29.63/16.71)	P....RTLrVRIRigNNQTGASASPQPVA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.30|      35|     118|     308|     345|       2
---------------------------------------------------------------------------
  308-  342 (58.96/29.38)	RTLGSYGVQSRDDTLICPLTSTKTAVFDLVPLGES
  427-  461 (58.34/28.96)	KPLPTFKVTSTPGTPPAQLPQAEQTILSLVDRLET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.96|      19|      25|     164|     183|       3
---------------------------------------------------------------------------
  164-  183 (26.57/20.30)	QSVDKTVDSILaSASRLEKE
  192-  210 (35.39/22.75)	QQVLAVSDSGW.SVCRLPKE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17712 with Med17 domain of Kingdom Fungi
Unable to open file!