Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MATGSPRDIAMTEGQTPPPIPSEEPKFGGFTRFEIELEFVQSLASPLYLNHLASLKYFENPAFVAYLSYLQYWSHPPYTKYLTYPGPTLKNLELLQQERFRADILSPDKVAELAEEGMKSGMEGPRS |
Length | 127 |
Position | Middle |
Organism | Pezoloma ericae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.434 |
Instability index | 53.28 |
Isoelectric point | 5.00 |
Molecular weight | 14377.16 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17705 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.63| 21| 22| 51| 71| 1 --------------------------------------------------------------------------- 51- 71 (37.06/21.81) HLASLKYFENPA.FVAYLSYLQ 75- 96 (34.58/19.96) HPPYTKYLTYPGpTLKNLELLQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GFTRF 2) LELLQQERFRADI 3) LSYLQYW 4) YTKYLTYPG | 29 92 67 78 | 33 104 73 86 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab