<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17702

Description RNA polymeras-like protein II mediator complex component Srb8
SequenceMTSRPSVGRQGPQRSLSSTNALQRPPPHRTLSQQFSSSSPTRRGNEGLEFTFDSDARHGPRVGTSRLRVEISKDSGASEMVESPKPLSDAAPSWRPSLPPRGRPQLHFDVPSVSNLSPRPAQEGGQIEATIKPMPLPVRPGQHAPPSTEKSRLAPSNAAKKDARPKPYVLEVPAAAPHYSPNGHVDFFPWTGNHPEDQFSEPAIKHGYFDKAQMTQNEQGTARQSIYPALKHKSGLHTLSALFTSVLAQRRAHGQITSASTFKPPPRVTVTDTKREMWLKDLANPTISLRRLSRSIPHGIRGKVLLDQSLSKNIPIERAVWLAKCVGANELRSFRRKGVSGTFAMGGEAKWIRDFTVCVEQFVESILGSCGEKDFKPRISYAIRLATHFHAEYLLDREHYMDWLVTSLENSPQAKLPMWLLITQVYWKDLLKYRKYGRRLSAALLNQLAETLNHPDHDILAPLSDRLRVLLKGIMASNSDNFVAPRVWAKHRHLIMNDMGSDDNPFMSILEALDRRNSLLNGPGAEKVLTARRRLLQLLDTTLSGSLTNETARQCWEIDEDKAMLSSALLEWSTSSYRPGNAKIYVAVRILRSWSKLGLDVTGVILDFLDSRVCCSGRHKPAFYHLVSELARSEHFFTPRYLQWLIARGGLYNAADAAPDGACATRLLAELPTHNLSESISELRATLLGRAGCLVEEEEDQASDLIAFMDRNLPGMQISGDDELRMESGSTNLASLSEASRTTKSELGLWLRQKVRLQMEQPTIPPLDDWDDSPMKGGTSAITSSDFNTIRQYLELIDDYSMLADVLKIVASSNDAEVLASCADTLNLHVELFSSIGALRRLFDILMSRLRALNDEIDPVPRVFLVTLSDLASRVPEQHMLAQQLALELVRSDRKTAADACSPVSDHMALLQTSEADFTDEIEKVLASGNSMDQATLERLFQRITLRLEESWEKSSDNQRSCGLLLTRLRTFDAQQFDSLMTAWVKRLLRIQNRPTMMQAFGPLISFGCLALQDVVVGSESVEAMGSVQDSSLAYEALELLVPSFTIPESMTLEEGYRLRIKQAHMQKDNPVEVLNVVRRVFEKALDLDKHSRSLDTEILRSAEFHELLQALVLSDTHRFVDSFVMPLLQSSAPEAVVVLNRCIDGFLLAGKEAEPVTTEVLLNLADDLSLPFCQVKLAAMFKRDDTVMEGADSGQSDDLEAFDRAIESAVAAGKTTWASIVPLLDPAIAQRLRHRAEVRFLALFPSPRATNGEDSMQTRIVHAENLLHIIDATAYSVATNKTSVGVTNLASDIVATLNGLWLLLANLQSPEIKDTIMSKWLPLLLSFTTIHIPSFEATKAGHESRAKAILALAAIFLQLQALDFTTEDIKNLAEQAFDLALFFVDALPEDMRQQCIRSLRDTASSPRVSYIFSFAPNPTEWLVLSQREKTQQVPSAGANDRAIEKEKLVPFALRRWEMLGEPTPNVGENDTSLSLTLFGARRG
Length1484
PositionKinase
OrganismPezoloma ericae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha.
Aromaticity0.07
Grand average of hydropathy-0.250
Instability index50.02
Isoelectric point6.17
Molecular weight165135.38
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17702
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     131.27|      36|      60|      25|      61|       1
---------------------------------------------------------------------------
   25-   61 (62.77/38.21)	PPPHRTLSQQFSSSSPTrRGNEGLEFTFDSDARHGPR
   84-  119 (68.50/37.85)	PKPLSDAAPSWRPSLPP.RGRPQLHFDVPSVSNLSPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.35|      21|      21|     462|     482|       2
---------------------------------------------------------------------------
  462-  482 (35.44/24.10)	P.LSDRLRVLLKGIMASNSDNF
  485-  506 (36.91/25.45)	PrVWAKHRHLIMNDMGSDDNPF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.27|      11|      24|    1113|    1126|       4
---------------------------------------------------------------------------
 1113- 1126 (15.55/17.93)	VLsdtHRFVDSFVM
 1139- 1149 (20.72/12.64)	VL...NRCIDGFLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     434.33|     144|     240|     305|     461|       5
---------------------------------------------------------------------------
  305-  461 (225.40/209.20)	LLDQSLSKNIPIERAvwlAKCVGANELRSFRRKGV...SGTFAMGGEAK..........WIR...DFTVCVEQFVESILgsCGEKDFKPRISYAI.RLATHFHaeYLLDRehYMDWLVT..SLENSPQAKlP....MWLLITQVYWKDLlkyRKYGRRLSAALLNQ...LAETLNHPDHDILA
  538-  707 (208.93/153.86)	LLDTTLSGSLTNETA...RQCWEIDEDKAMLSSALlewSTSSYRPGNAKiyvavrilrsWSKlglDVTGVILDFLDSRV..CCSGRHKPAFYHLVsELARSEH..FFTPR..YLQWLIArgGLYNAADAA.PdgacATRLLAELPTHNL...SESISELRATLLGRagcLVEEEEDQASDLIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.21|      16|      21|     965|     981|       8
---------------------------------------------------------------------------
  965-  981 (24.04/22.39)	LLtRL..RTFDAQQFDSLM
  988- 1005 (25.17/17.21)	LL.RIqnRPTMMQAFGPLI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17702 with Med12 domain of Kingdom Fungi
Unable to open file!