Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDEIIDKRFERVEKALATLITSISTYNPAPALANDLLSADTELSQGLDILSRHQSNYSKILSLRATSSELDTQIRETLNLLTKTRSELIATPSTDYPTNTNPVSYSELLSYARRISKFTLPPNYREPEVQTDGTTTPKESKSETQTNGTTTPVAATNGITSQTDLGTAMEIDDPAPADGATQTHTSQTSTVKTNTDMWSQWLNPAETQFVPWPSEETIRRGALASIQILVDQGIDPATFDPEKSAELEAERKRVEEEQEGLREQERARLEEERRREMERRMSVSGAAPERREEQPKVFQLETFDDDEDDD |
Length | 310 |
Position | Middle |
Organism | Pezoloma ericae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.857 |
Instability index | 54.81 |
Isoelectric point | 4.54 |
Molecular weight | 34801.75 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17699 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.23| 25| 29| 147| 175| 1 --------------------------------------------------------------------------- 133- 165 (37.47/18.50) GTT....TPKesksetqtNGTT.TPVAATNGITSQTDL 166- 197 (29.76/22.07) GTAmeidDPA......paDGATqTHTSQTSTVKTNTDM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.64| 28| 29| 237| 265| 2 --------------------------------------------------------------------------- 237- 265 (40.58/27.21) ATFDPEKSAELEaERKRVEEEQEGLREQE 267- 294 (46.05/26.90) ARLEEERRREME.RRMSVSGAAPERREEQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 90.59| 20| 47| 57| 76| 3 --------------------------------------------------------------------------- 57- 76 (30.16/16.90) YSKILSL..RATSSELDTQIRE 85- 104 (30.97/17.53) RSELIAT..PSTDYPTNTNPVS 105- 126 (29.46/16.35) YSELLSYarRISKFTLPPNYRE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RRREMERRMSVSGAAPERREEQPKVFQLETFDDDEDDD 2) VSYSELLSYARRIS | 273 103 | 310 116 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab