| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTQATLSQDDIKALEQTRQRLYQLSNNIASLKGDVLRSNPLPQWSSLQTSASILASNVVALTAHLNNHAELLSKTVVYPSTNYPGRTQEGLLSQLLRKKLEPHVETLVEEGRNIQAELKTADSEEALLIWAKDWLGERASTYAEDEAGDNYTVAEREMGIENVRTGLRRKLEESDSEDEDEDEDMEDAGVQVTSARRSSFGQVEFSLTEVKKEPKANAKASSVEDILRFATSGVAPGPLVSVRR |
| Length | 244 |
| Position | Head |
| Organism | Pezoloma ericae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Hyaloscyphaceae> Hyaloscypha. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.593 |
| Instability index | 53.57 |
| Isoelectric point | 4.82 |
| Molecular weight | 27015.65 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP17694
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.69| 17| 17| 58| 74| 2
---------------------------------------------------------------------------
58- 74 (26.18/19.45) VVALTAHLNNHAE..LLSK
76- 94 (23.50/16.74) VVYPSTNYPGRTQegLLSQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AKASSVEDILRFATSGVA 2) LVSVRR 3) QVEFSLTEVKKE | 218 239 202 | 235 244 213 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab