Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPYYRLYKDYEQDPTSAPEPPPPIQGTYLLYGANYTTDDVLPSLEDQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLIERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRHVLYHFMSTLSVWRREEAQRLLKEALGTLEGQ |
Length | 181 |
Position | Middle |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae> Lactucinae> Lactuca. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.598 |
Instability index | 64.64 |
Isoelectric point | 7.07 |
Molecular weight | 21133.91 |
Publications | PubMed=28401891 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP17688 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.49| 20| 20| 3| 22| 1 --------------------------------------------------------------------------- 3- 22 (43.14/21.78) TATYPPPPP...YYRLY.KDYEQD 24- 47 (31.35/14.23) TSAPEPPPPiqgTYLLYgANYTTD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.36| 15| 22| 129| 143| 2 --------------------------------------------------------------------------- 129- 143 (26.19/16.89) LIHILE.LQIQRRKQA 152- 167 (22.17/13.33) LYHFMStLSVWRREEA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IQGTYLLYGANY 2) MATATYPPPPPYYRLYKDYEQDPTSAP | 33 1 | 44 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab