<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17688
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYKDYEQDPTSAPEPPPPIQGTYLLYGANYTTDDVLPSLEDQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLIERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRHVLYHFMSTLSVWRREEAQRLLKEALGTLEGQ |
| Length | 181 |
| Position | Middle |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.598 |
| Instability index | 64.64 |
| Isoelectric point | 7.07 |
| Molecular weight | 21133.91 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17688
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.49| 20| 20| 3| 22| 1
---------------------------------------------------------------------------
3- 22 (43.14/21.78) TATYPPPPP...YYRLY.KDYEQD
24- 47 (31.35/14.23) TSAPEPPPPiqgTYLLYgANYTTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.36| 15| 22| 129| 143| 2
---------------------------------------------------------------------------
129- 143 (26.19/16.89) LIHILE.LQIQRRKQA
152- 167 (22.17/13.33) LYHFMStLSVWRREEA
---------------------------------------------------------------------------
|