<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17684

Description Uncharacterized protein
SequenceMRAPIRGGRGGSGGFRGGRGDGGGRGRGGGGGRGRGGGGFSGGRSAGGRGGGRGRGGGRGGRGGGMKGGSKVIVEPHRHDGVFIAKGKEDALCTRNMVPGEAVYNEKRISVQNEDGTKIEYRVWNPFRSKLAAAVLGGVDNIWMKPGSRVLYLGAASGTTVSHVSDLVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVSMVDVIFSDVAQPDQARILALNASYFLKSGGYFVISIKANCIDSTVPAEAVFASEVKKLQAEQFKPMEQVTLEPFERDHACVVGAYRVPKKQKSSS
Length310
PositionUnknown
OrganismLactuca sativa (Garden lettuce)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae> Lactucinae> Lactuca.
Aromaticity0.07
Grand average of hydropathy-0.374
Instability index36.96
Isoelectric point10.21
Molecular weight32676.82
Publications
PubMed=28401891

Function

Annotated function 
GO - Cellular Component
box C/D RNP complex	GO:0031428	IBA:GO_Central
Cajal body	GO:0015030	IBA:GO_Central
small-subunit processome	GO:0032040	IBA:GO_Central

GO - Biological Function
histone-glutamine methyltransferase activity	GO:1990259	IBA:GO_Central
RNA binding	GO:0003723	IBA:GO_Central
rRNA methyltransferase activity	GO:0008649	IBA:GO_Central

GO - Biological Process
box C/D RNA 3'-end processing	GO:0000494	IBA:GO_Central
histone glutamine methylation	GO:1990258	IBA:GO_Central
rRNA methylation	GO:0031167	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17684
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.12|      21|      25|       7|      30|       1
---------------------------------------------------------------------------
   20-   43 (45.42/15.21)	GDGGGRGRGGG.GGRGrggGGFSGG
   48-   69 (45.71/10.51)	GRGGGRGRGGGrGGRG...GGMKGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.90|      17|      17|     191|     207|       2
---------------------------------------------------------------------------
  171-  194 (19.98/10.68)	TGVVYAVEfshrsgrDLVNMAKKR
  195-  211 (29.92/18.78)	TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     190.53|      57|     161|      78|     137|       3
---------------------------------------------------------------------------
   78-  137 (91.45/87.50)	RHDGVFIAKGKedALCTRNMVPGEAVYNEKRISVQNEDGTKIEYRVWNPFRSKlAAAVLG
  242-  298 (99.08/81.45)	KSGGYFVISIK..ANCIDSTVPAEAVFASEVKKLQAEQFKPMEQVTLEPFERD.HACVVG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17684 with Med36 domain of Kingdom Viridiplantae
Unable to open file!