<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17679
| Description |
Uncharacterized protein |
| Sequence | MISTYLNNTTTTHSQSLTYSADQCSPYRLLLAFPWFANQIRFAKAHDSMFISERIENVVQNSARKPEKVSACSKCFNNPVAWSGNLNAIACASESCACIPSSNANPPFWIPIHIVIPERPTESTVFNVIAVAHRISTVIDSDMVMVLSFGEMMEYDAPSKLMESDSYFSKLVAEYWSICRT |
| Length | 181 |
| Position | Tail |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.008 |
| Instability index | 44.36 |
| Isoelectric point | 5.77 |
| Molecular weight | 20264.92 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17679
No repeats found
|