<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17673
Description |
Uncharacterized protein |
Sequence | MHHQVHHHLPSSLFSINIAQPPHSSLTVLQSQIHTTVKITPLLHTLTSISFHILEPHLRTRSVSIPNMVPLKKVTTGFGNGFQATPKTSTTNGIPSSLTPPSWDGFASLASYLFNWQEYSDSLLKMAVQVLQQALQSNHAPRAHLGLPELSLGVMPCFGGMAE |
Length | 163 |
Position | Tail |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.020 |
Instability index | 53.96 |
Isoelectric point | 8.94 |
Molecular weight | 17817.28 |
Publications | PubMed=28401891
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17673
No repeats found
|