<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17670

Description Uncharacterized protein
SequenceMDPESKRFGRGPKELTGGVDLINYYKLFPHYELFCKKSLPLSISDAHHLRNVVGDTVIRKGEGMELNQLIEKENTSFSKSRVTNTRIQPFDLNALRDAFYLRETFPIDLPPSEKGIPTQVGISKSESKDKEKKHKKHKDKNKEHKKHKHRSKHHDFGAENLKKPNDKKRKHDGDEDLNGIHRHKNSKHKMDRFGAIRIAA
Length200
PositionHead
OrganismLactuca sativa (Garden lettuce)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae> Lactucinae> Lactuca.
Aromaticity0.07
Grand average of hydropathy-1.194
Instability index38.22
Isoelectric point9.78
Molecular weight23176.11
Publications
PubMed=28401891

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
transcription factor binding	GO:0008134	IBA:GO_Central
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP17670
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.38|      10|      14|     130|     139|       1
---------------------------------------------------------------------------
  130-  139 (18.33/ 7.35)	KEKKHKKHKD
  146-  155 (19.06/ 7.93)	KHKHRSKHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.23|      29|     108|      59|      87|       3
---------------------------------------------------------------------------
   59-   87 (48.75/27.89)	RKGEGME.LNQLIEKENTSFSKSRVTNTRI
  169-  198 (48.48/27.70)	RKHDGDEdLNGIHRHKNSKHKMDRFGAIRI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP17670 with Med19 domain of Kingdom Viridiplantae

Unable to open file!