<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17665
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSHEDDDSSNTHSSPKKVYQDPDDGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKYIMYPHCLYFLELLQNASFRNAMAHPANKELTHRQQFYFWKNYRNNRLKHILPRPLPETTAPPPSNAVPPPPTTTIAAASSGGPVAVPPVLSPMQYGVPSGPPLKSDPRSGIDRRKRKKDG |
Length | 199 |
Position | Middle |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.767 |
Instability index | 61.32 |
Isoelectric point | 9.11 |
Molecular weight | 22952.73 |
Publications | PubMed=28401891
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17665
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.75| 20| 27| 31| 55| 1
---------------------------------------------------------------------------
31- 50 (37.33/18.16) FLLELEFIQCLANPTYIHYL
61- 80 (37.41/25.79) FIGYLKYLQYWQRPEYIKYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.99| 12| 15| 139| 150| 2
---------------------------------------------------------------------------
139- 150 (25.57/10.94) APPPSNAVPPPP
156- 167 (21.42/ 8.19) AASSGGPVAVPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.66| 19| 26| 86| 104| 3
---------------------------------------------------------------------------
82- 102 (27.90/16.54) YP........hcLYFLELLQNASFRNAMA
103- 131 (29.76/18.06) HPankelthrqqFYFWKNYRNNRLKHILP
---------------------------------------------------------------------------
|