<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17655

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQNVPHQMIQSPARLGLPNPNSPSLQTPAPPKFTSQIPQSHPPNLHPNLQTTPTSLTLLPLLPPLQRAQSILLRMSSLTTKLFDVSPNQTQWLTSFRGSFPTFLSTQTQAPTDSIPTTTKEIISLFTTLQSQLFESVTELQEILDLQDAKQKITREIRSKDSAILAFANKLKESERVLDMLVDDYSDYRRLKRSKVEESEEDSNTTTVATRLNLNDILSYAHRISYTTFAPPEFGAGTAPLRGALPPAPQEEQMRASQLYLFADMDVGLPKSDKEKFTIEPLAENMLEGNMAIKDMLPTNIVVPSGWKPGMPVQLPTDLPILPPAGWKPGDPVALPPLDSVAVAPRMEEQQQPVHVPGFGKGPQPIQVRHVQLDIDDDSDTEYSSDDSSDDED
Length394
PositionMiddle
OrganismLactuca sativa (Garden lettuce)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae> Lactucinae> Lactuca.
Aromaticity0.06
Grand average of hydropathy-0.468
Instability index71.27
Isoelectric point4.80
Molecular weight43659.91
Publications
PubMed=28401891

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP17655
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.32|      16|      19|     299|     317|       1
---------------------------------------------------------------------------
  302-  317 (35.64/24.30)	IVVPSGWKPGMPVQLP
  322-  337 (35.68/15.79)	ILPPAGWKPGDPVALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      87.93|      20|      20|     104|     123|       2
---------------------------------------------------------------------------
   76-   94 (26.41/13.06)	.MSSLTTKLFDVSPNQTQWL
  104-  123 (34.01/18.79)	FLSTQTQAPTDSIPTTTKEI
  127-  144 (27.51/13.88)	FTTLQSQL.FESV.TELQEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.03|       9|      19|       4|      14|       3
---------------------------------------------------------------------------
    4-   14 (13.69/11.52)	NVPHQmiQSPA
   22-   30 (17.34/ 7.54)	NSPSL..QTPA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP17655 with Med4 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) DLPILPPAGWKPGDPVALPPLDSVAVAPRMEEQQQPVHVPGFGKGP
2) MLQNVPHQMIQSPARLGLPNPNSPSLQTPAPPKFTSQIPQSHPPNLHPNLQTTP
319
1
364
54

Molecular Recognition Features

MoRF SequenceStartStop
1) GPQPIQVRHVQLDIDDDSDTEYSSDDSS
363
390