<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17655
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNVPHQMIQSPARLGLPNPNSPSLQTPAPPKFTSQIPQSHPPNLHPNLQTTPTSLTLLPLLPPLQRAQSILLRMSSLTTKLFDVSPNQTQWLTSFRGSFPTFLSTQTQAPTDSIPTTTKEIISLFTTLQSQLFESVTELQEILDLQDAKQKITREIRSKDSAILAFANKLKESERVLDMLVDDYSDYRRLKRSKVEESEEDSNTTTVATRLNLNDILSYAHRISYTTFAPPEFGAGTAPLRGALPPAPQEEQMRASQLYLFADMDVGLPKSDKEKFTIEPLAENMLEGNMAIKDMLPTNIVVPSGWKPGMPVQLPTDLPILPPAGWKPGDPVALPPLDSVAVAPRMEEQQQPVHVPGFGKGPQPIQVRHVQLDIDDDSDTEYSSDDSSDDED |
| Length | 394 |
| Position | Middle |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.468 |
| Instability index | 71.27 |
| Isoelectric point | 4.80 |
| Molecular weight | 43659.91 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17655
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.32| 16| 19| 299| 317| 1
---------------------------------------------------------------------------
302- 317 (35.64/24.30) IVVPSGWKPGMPVQLP
322- 337 (35.68/15.79) ILPPAGWKPGDPVALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.93| 20| 20| 104| 123| 2
---------------------------------------------------------------------------
76- 94 (26.41/13.06) .MSSLTTKLFDVSPNQTQWL
104- 123 (34.01/18.79) FLSTQTQAPTDSIPTTTKEI
127- 144 (27.51/13.88) FTTLQSQL.FESV.TELQEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.03| 9| 19| 4| 14| 3
---------------------------------------------------------------------------
4- 14 (13.69/11.52) NVPHQmiQSPA
22- 30 (17.34/ 7.54) NSPSL..QTPA
---------------------------------------------------------------------------
|