<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17644
| Description |
Uncharacterized protein |
| Sequence | MAAAGALAVKTLEFEGKQKGWFWFRKWDLEDMSSICWFTGIHVLAACAPFVFDRGAIRLCVGFALLSAFGMTLGYHRLLCHRSFKIPKWLEYFFVYCGAHAFQEGKRGGVWKNIARGGAALTLPLTASFPIFYWIFMILLSPKLEKSGGTELSSRFPTPKRRRHRRTTLKLRTLNGGDRPLLRVLAPSGNTSVPLQYLKTLGSGSEWQDFRLNFTMNKGGAGGGTSGAGGPTAAAAAAAAQKQKSLQQRVDNDIGSIVDNFSIVVNVARVNDPPVRNSQEAFMMEVRASRMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRTEELNHQAEKTDKILARIGEDAAASLKEMESHYYSSLVRSTKSNQHFHDQ |
| Length | 374 |
| Position | Head |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.185 |
| Instability index | 41.90 |
| Isoelectric point | 9.70 |
| Molecular weight | 41412.04 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17644
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 14| 15| 142| 155| 1
---------------------------------------------------------------------------
142- 155 (23.40/16.43) PKLEKSGGTELSSR
159- 172 (24.69/17.72) PKRRRHRRTTLKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.28| 14| 15| 75| 88| 3
---------------------------------------------------------------------------
75- 88 (27.26/16.42) YHRLLC.HRSFKIPK
92- 106 (23.02/12.96) YFFVYCgAHAFQEGK
---------------------------------------------------------------------------
|