<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17640
Description |
Uncharacterized protein |
Sequence | MDPESKKFGKGPRELTGAVDLISYYKLLPHHEFFCKKPLPLSISDTHYLHNVVGDSEIRKGEGMQLDQLIQNNNNSTSRETNTRIQPFDLDTLREAFQLRETSSPVDLPSSEKGTPTVAGKSRSESKEKEKKHKKHKDKDREKDKEHKKHKHRHKDRSKDKDKEKKKDKSSHHEKKRKHDGDEDINDIHRHKKSKHKSSSKMDEMGAIKVAG |
Length | 212 |
Position | Head |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.577 |
Instability index | 42.80 |
Isoelectric point | 9.56 |
Molecular weight | 24570.32 |
Publications | PubMed=28401891
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.96| 15| 15| 130| 144| 1
---------------------------------------------------------------------------
125- 142 (21.08/ 6.74) ESkekEKKHKKHKDKDRE
143- 158 (23.88/ 8.62) KD..kEHKKHKHRHKDRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.15| 13| 15| 167| 179| 2
---------------------------------------------------------------------------
167- 179 (23.98/ 8.94) KD.KSSHHEKKRKH
183- 196 (20.17/ 6.56) EDiNDIHRHKKSKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.91| 9| 19| 79| 90| 3
---------------------------------------------------------------------------
79- 90 (12.92/16.64) RETNTriqPFDL
100- 108 (16.99/10.42) RETSS...PVDL
---------------------------------------------------------------------------
|