<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17638
Description |
Uncharacterized protein |
Sequence | MDGFISLTIRHEDLNSSLFRYMVREMLACAVIRPVINLADPRFISVRIENVVENSARKPEKVSACSKCFNSPVAWSGNLNAIACASESCARIPRRNSWFIYFLLGTVAHRISTVIDSDMVMVLSFGEMMEYDAPSKLMESDSYFSKLVAEYWSICMT |
Length | 157 |
Position | Tail |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
Aromaticity | 0.10 |
Grand average of hydropathy | 0.167 |
Instability index | 46.48 |
Isoelectric point | 6.11 |
Molecular weight | 17784.48 |
Publications | PubMed=28401891
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17638
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.93| 14| 74| 50| 76| 1
---------------------------------------------------------------------------
50- 63 (22.91/31.11) NVVENSARKPEKVS
84- 97 (26.02/ 6.37) CASESCARIPRRNS
---------------------------------------------------------------------------
|