| Description | Pectin acetylesterase |
| Sequence | MINRTHPHSFCYLLKLIFFHSTDFFNWNKVKIRYCDGASFAGHPESEQKVCSFLGIRQDKMQAIRRNKCSRGESNGVGYMQARLLLDMLGKGIESALIDPSALVDKPWSTLQRVKTLSLGHCQFQREDTKEQSDSDALENNPQYRLGVEFS |
| Length | 151 |
| Position | Tail |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae> Lactucinae> Lactuca. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.514 |
| Instability index | 31.69 |
| Isoelectric point | 8.62 |
| Molecular weight | 17320.54 |
| Publications | PubMed=28401891 |
| Annotated function |
Hydrolyzes acetyl esters in homogalacturonan regions of
pectin. In type I primary cell wall, galacturonic acid residues of
pectin can be acetylated at the O-2 and O-3 positions. Decreasing the
degree of acetylation of pectin gels in vitro alters their physical
properties.
ECO:0000256 ARBA:ARBA00003534 ECO:0000256 RuleBase:RU363114 |
| GO - Cellular Component | cell wall GO:0005618 IEA:UniProtKB-SubCell extracellular region GO:0005576 IEA:UniProtKB-KW |
| GO - Biological Function | hydrolase activity GO:0016787 IEA:UniProtKB-KW |
| GO - Biological Process | cell wall organization GO:0071555 IEA:UniProtKB-KW |
| Binary Interactions |
| Repeats | >MDP17631 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AIRRNK 2) SDALENNPQYRLGVEFS | 63 135 | 68 151 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab