<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17631
| Description |
Pectin acetylesterase |
| Sequence | MINRTHPHSFCYLLKLIFFHSTDFFNWNKVKIRYCDGASFAGHPESEQKVCSFLGIRQDKMQAIRRNKCSRGESNGVGYMQARLLLDMLGKGIESALIDPSALVDKPWSTLQRVKTLSLGHCQFQREDTKEQSDSDALENNPQYRLGVEFS |
| Length | 151 |
| Position | Tail |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.514 |
| Instability index | 31.69 |
| Isoelectric point | 8.62 |
| Molecular weight | 17320.54 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
Hydrolyzes acetyl esters in homogalacturonan regions of
pectin. In type I primary cell wall, galacturonic acid residues of
pectin can be acetylated at the O-2 and O-3 positions. Decreasing the
degree of acetylation of pectin gels in vitro alters their physical
properties.
|
| GO - Cellular Component | cell wall GO:0005618 IEA:UniProtKB-SubCell
extracellular region GO:0005576 IEA:UniProtKB-KW
|
| GO - Biological Function | hydrolase activity GO:0016787 IEA:UniProtKB-KW
|
| GO - Biological Process | cell wall organization GO:0071555 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP17631
No repeats found
No repeats found
|