<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17617
| Description |
Uncharacterized protein |
| Sequence | MKGKLGKNLWGEELVILAEASMEPTVIYVKQVLDIISKASNKGIKGIAHIPGGGFIDTICRVFGIGLGALVYNDSCSVPPVFKWIQKAGGIEDGEMKRTFNMGIRMVLVVSKEVSERVVKEEGEMVYRVGEVFSDSPRDSVQFIECSPSSCPRALPGEVRKYGTTIAPGLYAPVHQHFFVARMDMAVDCKPGEAYTQVEADVKVEEPGKDNVHNNTFYTQETLNHKQCGIVIRYLLAIGSFLEIDLGHLKVTNEVSWHGPAEDQASVHCDYFLGFPFHQLSCHEFG |
| Length | 286 |
| Position | Tail |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.076 |
| Instability index | 38.25 |
| Isoelectric point | 5.70 |
| Molecular weight | 31612.95 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
|
| GO - Cellular Component | cytosol GO:0005829 IBA:GO_Central
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
copper ion binding GO:0005507 IEA:InterPro
phosphoribosylamine-glycine ligase activity GO:0004637 IBA:GO_Central
phosphoribosylformylglycinamidine cyclo-ligase activity GO:0004641 IBA:GO_Central
primary amine oxidase activity GO:0008131 IEA:InterPro
quinone binding GO:0048038 IEA:InterPro
|
| GO - Biological Process | 'de novo' IMP biosynthetic process GO:0006189 IEA:UniProtKB-UniPathway
adenine biosynthetic process GO:0046084 IBA:GO_Central
amine metabolic process GO:0009308 IEA:InterPro
purine nucleotide biosynthetic process GO:0006164 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17617
No repeats found
No repeats found
|