<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17606
Description |
Uncharacterized protein |
Sequence | MKNSFGATIDAYTEQLGKYFEQSAKSSEKQVAKEAIFYGALIRLQQNWKVKRHRMVASAAGNEGKNPALRGWIRPKNVKED |
Length | 81 |
Position | Head |
Organism | Lactuca sativa (Garden lettuce) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.793 |
Instability index | 45.26 |
Isoelectric point | 9.93 |
Molecular weight | 9186.37 |
Publications | PubMed=28401891
|
Function
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP17606
No repeats found
No repeats found
|