<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17595
| Description |
Uncharacterized protein |
| Sequence | MDPESKNFGRGPRELTGAVDLISYYKLLPHYEFFCKKSLPLSLSDTHYLHDVIGDTEIRKGEGMQLDQLLQYNNSFSRDTNTRIQPFDLDLLREAFQLKETAPVDLPSSEKGMPTIPGKSKSEVKDKEKKHKKHKDKDKEHKKHKHRHKDRSKDKDKDKKKDKSSHHDSGAEHSKKHHEKKRKHDGNEDVNDIHRQKKSKHKSSKIDEIGGIKIAA |
| Length | 216 |
| Position | Head |
| Organism | Lactuca sativa (Garden lettuce) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Cichorioideae> Cichorieae>
Lactucinae> Lactuca.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.452 |
| Instability index | 34.71 |
| Isoelectric point | 9.47 |
| Molecular weight | 25055.95 |
| Publications | PubMed=28401891
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP17595
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.09| 14| 15| 136| 150| 1
---------------------------------------------------------------------------
136- 150 (22.38/11.41) DKDKEHKKhKHRHKD
168- 181 (22.72/ 7.49) DSGAEHSK.KHHEKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.38| 11| 29| 125| 135| 2
---------------------------------------------------------------------------
125- 135 (20.64/ 6.84) KDKEKKHKKHK
153- 163 (19.75/ 6.27) KDKDKDKKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.43| 14| 21| 55| 69| 3
---------------------------------------------------------------------------
55- 69 (20.25/21.98) DTEIRKgEGMQLDQL
79- 92 (25.18/20.14) DTNTRI.QPFDLDLL
---------------------------------------------------------------------------
|